![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (20 proteins) Heme-binding protein |
![]() | Protein Leghemoglobin [46481] (2 species) |
![]() | Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries) |
![]() | Domain d1gdk__: 1gdk - [15215] complexed with hem, isq |
PDB Entry: 1gdk (more details), 1.8 Å
SCOP Domain Sequences for d1gdk__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gdk__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)} galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike vvgakwseelnsawtiaydelaivikkemddaa
Timeline for d1gdk__: