Lineage for d2rlbb_ (2rlb B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1801870Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 1801871Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 1801872Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 1801873Protein Cation-dependent mannose 6-phosphate receptor, extracytoplasmic domain [50913] (1 species)
  7. 1801874Species Cow (Bos taurus) [TaxId:9913] [50914] (11 PDB entries)
  8. 1801880Domain d2rlbb_: 2rlb B: [152149]
    automated match to d1c39a_
    complexed with m6d, nag

Details for d2rlbb_

PDB Entry: 2rlb (more details), 1.75 Å

PDB Description: crystal structure cation-dependent mannose 6-phosphate receptor at ph 6.5 bound to m6p in absence of mn
PDB Compounds: (B:) Cation-dependent mannose-6-phosphate receptor

SCOPe Domain Sequences for d2rlbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rlbb_ b.64.1.1 (B:) Cation-dependent mannose 6-phosphate receptor, extracytoplasmic domain {Cow (Bos taurus) [TaxId: 9913]}
ektcdlvgekgkesekelallkrltplfqksfestvgqspdmysyvfrvcreagqhssga
glvqiqksngketvvgrfnetqifqgsnwimliykggdeydnhcgreqrravvmiscnrh
tladnfnpvseergkvqdcfylfemdsslacs

SCOPe Domain Coordinates for d2rlbb_:

Click to download the PDB-style file with coordinates for d2rlbb_.
(The format of our PDB-style files is described here.)

Timeline for d2rlbb_: