SCOP 1.73: Domain d1gdia_: 1gdi A:

Lineage for d1gdia_ (1gdi A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Leghemoglobin [46481] (2 species)

7. Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)

8. Domain d1gdia_: 1gdi A: [15214]
   complexed with cmo, hem

Details for d1gdia_

PDB Entry: 1gdi, 1.8 Å

PDB Description: crystal structure of ferric complexes of the yellow lupin leghemoglobin with isoquinoline at 1.8 angstroms resolution (russian)

PDB Compounds: (A:) leghemoglobin (carbonmonoxy)

SCOP Domain Sequences for d1gdia_:

Sequence; same for both SEQRES and ATOM records:

>d1gdia_ a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxId: 3873]}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

Timeline for d1gdia_:

• d1gdia_ first appeared (with stable ids) in SCOP 1.55, called d1gdi__
  
• d1gdia_ was called d1gdi__ in SCOP 1.71
  
• d1gdia_ appears in SCOP 1.75
  
• d1gdia_ appears in the current release, SCOPe 2.08