SCOP 1.65: Domain d1gdi__: 1gdi -

Lineage for d1gdi__ (1gdi -)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Leghemoglobin [46481] (2 species)

7. Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)

8. Domain d1gdi__: 1gdi - [15214]
   complexed with cmo, hem

Details for d1gdi__

PDB Entry: 1gdi, 1.8 Å

PDB Description: crystal structure of ferric complexes of the yellow lupin leghemoglobin with isoquinoline at 1.8 angstroms resolution (russian)

SCOP Domain Sequences for d1gdi__:

Sequence; same for both SEQRES and ATOM records:

>d1gdi__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

Timeline for d1gdi__:

• d1gdi__ first appeared (with stable ids) in SCOP 1.55
  
• d1gdi__ appears in SCOP 1.63
  
• d1gdi__ appears in SCOP 1.67
  
• d1gdi__ appears in the current release, SCOPe 2.08, called d1gdia_