| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Leghemoglobin [46481] (2 species) |
| Species Yellow lupine (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries) |
| Domain d1gdia_: 1gdi A: [15214] complexed with cmo, hem |
PDB Entry: 1gdi (more details), 1.8 Å
SCOPe Domain Sequences for d1gdia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gdia_ a.1.1.2 (A:) Leghemoglobin {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa
Timeline for d1gdia_: