![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.27: FnI-like domain [57602] (1 superfamily) disulfide-rich, all-beta |
![]() | Superfamily g.27.1: FnI-like domain [57603] (3 families) ![]() |
![]() | Family g.27.1.1: Fibronectin type I module [57604] (2 proteins) automatically mapped to Pfam PF00039 |
![]() | Protein Fibronectin [57605] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries) |
![]() | Domain d2rl0i1: 2rl0 I:153-197 [152136] automatically matched to d1fbra1 |
PDB Entry: 2rl0 (more details), 2 Å
SCOPe Domain Sequences for d2rl0i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rl0i1 g.27.1.1 (I:153-197) Fibronectin {Human (Homo sapiens) [TaxId: 9606]} ekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsr
Timeline for d2rl0i1: