Lineage for d1gdj__ (1gdj -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531529Protein Leghemoglobin [46481] (2 species)
  7. 531535Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)
  8. 531537Domain d1gdj__: 1gdj - [15213]
    complexed with hem

Details for d1gdj__

PDB Entry: 1gdj (more details), 1.7 Å

PDB Description: crystal structure of ferric complexes of the yellow lupin leghemoglobin with isoquinoline at 1.8 angstroms resolution (russian)

SCOP Domain Sequences for d1gdj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdj__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

SCOP Domain Coordinates for d1gdj__:

Click to download the PDB-style file with coordinates for d1gdj__.
(The format of our PDB-style files is described here.)

Timeline for d1gdj__: