SCOPe 2.08: Domain d2rkzf1: 2rkz F:63-108

Lineage for d2rkzf1 (2rkz F:63-108)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (3 families)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
   automatically mapped to Pfam PF00039

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries)

8. Domain d2rkzf1: 2rkz F:63-108 [152126]
   automatically matched to d1o9aa2
   complexed with sin

Details for d2rkzf1

PDB Entry: 2rkz, 2 Å

PDB Description: crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1

PDB Compounds: (F:) Fibronectin

SCOPe Domain Sequences for d2rkzf1:

Sequence; same for both SEQRES and ATOM records:

>d2rkzf1 g.27.1.1 (F:63-108) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
eetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctian

Timeline for d2rkzf1:

• d2rkzf1 first appeared in SCOP 1.75
  
• d2rkzf1 appears in SCOPe 2.07