| Class g: Small proteins [56992] (90 folds) |
| Fold g.27: FnI-like domain [57602] (1 superfamily) disulfide-rich, all-beta |
Superfamily g.27.1: FnI-like domain [57603] (2 families) ![]() |
| Family g.27.1.1: Fibronectin type I module [57604] (2 proteins) automatically mapped to Pfam PF00039 |
| Protein Fibronectin [57605] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57606] (13 PDB entries) |
| Domain d2rkzd2: 2rkz D:109-151 [152123] automatically matched to d2cg6a1 complexed with ace, nh2, sin |
PDB Entry: 2rkz (more details), 2 Å
SCOPe Domain Sequences for d2rkzd2:
Sequence, based on SEQRES records: (download)
>d2rkzd2 g.27.1.1 (D:109-151) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
rcheggqsykigdtwrrphetggymlecvclgngkgewtckpi
>d2rkzd2 g.27.1.1 (D:109-151) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
rcheggqsykigdtwrrphymlecvclgngkgewtckpi
Timeline for d2rkzd2: