SCOPe 2.05: Domain d2rkzc2: 2rkz C:109-151

Lineage for d2rkzc2 (2rkz C:109-151)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (3 families)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
   automatically mapped to Pfam PF00039

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries)

8. Domain d2rkzc2: 2rkz C:109-151 [152121]
   automatically matched to d2cg6a1
   complexed with ace, nh2, sin

Details for d2rkzc2

PDB Entry: 2rkz, 2 Å

PDB Description: crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-1

PDB Compounds: (C:) Fibronectin

SCOPe Domain Sequences for d2rkzc2:

Sequence; same for both SEQRES and ATOM records:

>d2rkzc2 g.27.1.1 (C:109-151) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
rcheggqsykigdtwrrphetggymlecvclgngkgewtckpi

Timeline for d2rkzc2:

• d2rkzc2 first appeared in SCOP 1.75
  
• d2rkzc2 appears in SCOPe 2.04
  
• d2rkzc2 appears in SCOPe 2.06
  
• d2rkzc2 appears in the current release, SCOPe 2.08