Lineage for d2gdm__ (2gdm -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 350060Protein Leghemoglobin [46481] (2 species)
  7. 350066Species Yellow lupin (Lupinus luteus) [TaxId:3873] [46482] (17 PDB entries)
  8. 350067Domain d2gdm__: 2gdm - [15212]
    complexed with hem, oxy

Details for d2gdm__

PDB Entry: 2gdm (more details), 1.7 Å

PDB Description: leghemoglobin (oxy)

SCOP Domain Sequences for d2gdm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdm__ a.1.1.2 (-) Leghemoglobin {Yellow lupin (Lupinus luteus)}
galtesqaalvkssweefnanipkhthrffilvleiapaakdlfsflkgtsevpqnnpel
qahagkvfklvyeaaiqlevtgvvvtdatlknlgsvhvskgvadahfpvvkeailktike
vvgakwseelnsawtiaydelaivikkemddaa

SCOP Domain Coordinates for d2gdm__:

Click to download the PDB-style file with coordinates for d2gdm__.
(The format of our PDB-style files is described here.)

Timeline for d2gdm__: