Lineage for d1ecda_ (1ecd A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1253857Protein Erythrocruorin [46479] (1 species)
  7. 1253858Species Midge (Chironomus thummi thummi), fraction III [TaxId:7154] [46480] (4 PDB entries)
  8. 1253860Domain d1ecda_: 1ecd A: [15211]
    complexed with hem

Details for d1ecda_

PDB Entry: 1ecd (more details), 1.4 Å

PDB Description: structure of erythrocruorin in different ligand states refined at 1.4 angstroms resolution
PDB Compounds: (A:) erythrocruorin (aquo met)

SCOPe Domain Sequences for d1ecda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}
lsadqistvqasfdkvkgdpvgilyavfkadpsimakftqfagkdlesikgtapfethan
rivgffskiigelpnieadvntfvashkprgvthdqlnnfragfvsymkahtdfagaeaa
wgatldtffgmifskm

SCOPe Domain Coordinates for d1ecda_:

Click to download the PDB-style file with coordinates for d1ecda_.
(The format of our PDB-style files is described here.)

Timeline for d1ecda_: