![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Erythrocruorin [46479] (1 species) |
![]() | Species Midge (Chironomus thummi thummi), fraction III [TaxId:7154] [46480] (4 PDB entries) |
![]() | Domain d1ecd__: 1ecd - [15211] complexed with hem |
PDB Entry: 1ecd (more details), 1.4 Å
SCOP Domain Sequences for d1ecd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ecd__ a.1.1.2 (-) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III} lsadqistvqasfdkvkgdpvgilyavfkadpsimakftqfagkdlesikgtapfethan rivgffskiigelpnieadvntfvashkprgvthdqlnnfragfvsymkahtdfagaeaa wgatldtffgmifskm
Timeline for d1ecd__: