Lineage for d1ecd__ (1ecd -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) 
Protein Erythrocruorin [46479] (1 species) Species Midge (Chironomus thummi thummi), fraction III [TaxId:7154] [46480] (4 PDB entries) 
Domain d1ecd__: 1ecd - [15211]
Details for d1ecd__
PDB Entry: 1ecd (more details), 1.4 Å
PDB Description: structure of erythrocruorin in different ligand states refined at 1.4 angstroms resolution
SCOP Domain Sequences for d1ecd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ecd__ a.1.1.2 (-) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III}
lsadqistvqasfdkvkgdpvgilyavfkadpsimakftqfagkdlesikgtapfethan
rivgffskiigelpnieadvntfvashkprgvthdqlnnfragfvsymkahtdfagaeaa
wgatldtffgmifskm
SCOP Domain Coordinates for d1ecd__:
Click to download the PDB-style file with coordinates for d1ecd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ecd__:
- d1ecd__ appears in SCOP 1.57
- d1ecd__ appears in the current release, SCOPe 2.08, called d1ecda_
View in 3D