SCOPe 2.08: Domain d2rk5a1: 2rk5 A:5-88

Lineage for d2rk5a1 (2rk5 A:5-88)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
   Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain

6. Protein Putative hemolysin SMU1693 [160821] (1 species)
   HlyX

7. Species Streptococcus mutans [TaxId:1309] [160822] (1 PDB entry)
   Uniprot O68574 352-435

8. Domain d2rk5a1: 2rk5 A:5-88 [152108]
   Other proteins in same PDB: d2rk5a2

Details for d2rk5a1

PDB Entry: 2rk5, 1.5 Å

PDB Description: Crystal structure of a domain of the putative hemolysin from Streptococcus mutans UA159

PDB Compounds: (A:) Putative hemolysin

SCOPe Domain Sequences for d2rk5a1:

Sequence; same for both SEQRES and ATOM records:

>d2rk5a1 d.145.1.4 (A:5-88) Putative hemolysin SMU1693 {Streptococcus mutans [TaxId: 1309]}
reiadntyivlgtmtlndfneyfetdlesdnvdtiagfyltgvgtipsqeekehfevesn
gkhlelindkvkdgrvtklkilvs

Timeline for d2rk5a1:

• d2rk5a1 first appeared in SCOP 1.75
  
• d2rk5a1 appears in SCOPe 2.07