![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) ![]() |
![]() | Family b.34.4.1: R67 dihydrofolate reductase [50091] (1 protein) |
![]() | Protein R67 dihydrofolate reductase [50092] (1 species) |
![]() | Species Escherichia coli, plasmid PLZ1 [TaxId:562] [50093] (6 PDB entries) |
![]() | Domain d2rk2a1: 2rk2 A:21-78 [152107] automatically matched to d1viea_ complexed with mrd, nap |
PDB Entry: 2rk2 (more details), 1.9 Å
SCOP Domain Sequences for d2rk2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rk2a1 b.34.4.1 (A:21-78) R67 dihydrofolate reductase {Escherichia coli, plasmid PLZ1 [TaxId: 562]} natfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin
Timeline for d2rk2a1: