Lineage for d2rk2a1 (2rk2 A:21-78)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796525Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 796526Family b.34.4.1: R67 dihydrofolate reductase [50091] (1 protein)
  6. 796527Protein R67 dihydrofolate reductase [50092] (1 species)
  7. 796528Species Escherichia coli, plasmid PLZ1 [TaxId:562] [50093] (6 PDB entries)
  8. 796532Domain d2rk2a1: 2rk2 A:21-78 [152107]
    automatically matched to d1viea_
    complexed with mrd, nap

Details for d2rk2a1

PDB Entry: 2rk2 (more details), 1.9 Å

PDB Description: DHFR R-67 complexed with NADP
PDB Compounds: (A:) Dihydrofolate reductase type 2

SCOP Domain Sequences for d2rk2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rk2a1 b.34.4.1 (A:21-78) R67 dihydrofolate reductase {Escherichia coli, plasmid PLZ1 [TaxId: 562]}
natfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin

SCOP Domain Coordinates for d2rk2a1:

Click to download the PDB-style file with coordinates for d2rk2a1.
(The format of our PDB-style files is described here.)

Timeline for d2rk2a1: