![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
![]() | Family b.34.4.1: R67 dihydrofolate reductase [50091] (2 proteins) |
![]() | Protein automated matches [190309] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187228] (8 PDB entries) |
![]() | Domain d2rk2a_: 2rk2 A: [152107] automated match to d1viea_ complexed with mrd, nap |
PDB Entry: 2rk2 (more details), 1.9 Å
SCOPe Domain Sequences for d2rk2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rk2a_ b.34.4.1 (A:) automated matches {Escherichia coli [TaxId: 562]} natfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin
Timeline for d2rk2a_: