Lineage for d2rk1a_ (2rk1 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784139Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 1784140Family b.34.4.1: R67 dihydrofolate reductase [50091] (2 proteins)
  6. 1784145Protein automated matches [190309] (1 species)
    not a true protein
  7. 1784146Species Escherichia coli [TaxId:562] [187228] (6 PDB entries)
  8. 1784150Domain d2rk1a_: 2rk1 A: [152106]
    automated match to d1viea_
    complexed with dhf, mrd, nap

Details for d2rk1a_

PDB Entry: 2rk1 (more details), 1.26 Å

PDB Description: DHFR R67 Complexed with NADP and dihydrofolate
PDB Compounds: (A:) Dihydrofolate reductase type 2

SCOPe Domain Sequences for d2rk1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rk1a_ b.34.4.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
natfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin

SCOPe Domain Coordinates for d2rk1a_:

Click to download the PDB-style file with coordinates for d2rk1a_.
(The format of our PDB-style files is described here.)

Timeline for d2rk1a_: