Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.1: R67 dihydrofolate reductase [50091] (2 proteins) |
Protein automated matches [190309] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [187228] (6 PDB entries) |
Domain d2rk1a_: 2rk1 A: [152106] automated match to d1viea_ complexed with dhf, mrd, nap |
PDB Entry: 2rk1 (more details), 1.26 Å
SCOPe Domain Sequences for d2rk1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rk1a_ b.34.4.1 (A:) automated matches {Escherichia coli [TaxId: 562]} natfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin
Timeline for d2rk1a_: