Lineage for d1ecn__ (1ecn -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 530545Protein Erythrocruorin [46479] (1 species)
  7. 530546Species Midge (Chironomus thummi thummi), fraction III [TaxId:7154] [46480] (4 PDB entries)
  8. 530549Domain d1ecn__: 1ecn - [15210]
    complexed with hem

Details for d1ecn__

PDB Entry: 1ecn (more details), 1.4 Å

PDB Description: structure of erythrocruorin in different ligand states refined at 1.4 angstroms resolution

SCOP Domain Sequences for d1ecn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecn__ a.1.1.2 (-) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III}
lsadqistvqasfdkvkgdpvgilyavfkadpsimakftqfagkdlesikgtapfethan
rivgffskiigelpnieadvntfvashkprgvthdqlnnfragfvsymkahtdfagaeaa
wgatldtffgmifskm

SCOP Domain Coordinates for d1ecn__:

Click to download the PDB-style file with coordinates for d1ecn__.
(The format of our PDB-style files is described here.)

Timeline for d1ecn__: