SCOPe 2.07: Domain d2riua_: 2riu A:

Lineage for d2riua_ (2riu A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.115: YrdC/RibB [55820] (1 superfamily)
   core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other

4. Superfamily d.115.1: YrdC/RibB [55821] (3 families)

5. Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
   contains one additional helix in the C-terminal extension
   automatically mapped to Pfam PF00926

6. Protein automated matches [190415] (4 species)
   not a true protein

7. Species Yeast (Candida albicans) [TaxId:5476] [187291] (2 PDB entries)

8. Domain d2riua_: 2riu A: [152099]
   automated match to d1tksa_
   complexed with 5rp

Details for d2riua_

PDB Entry: 2riu, 1.7 Å

PDB Description: Alternative models for two crystal structures of Candida albicans 3,4-dihydroxy-2-butanone 4-phosphate synthase- alternate interpreation

PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d2riua_:

Sequence, based on SEQRES records:

>d2riua_ d.115.1.2 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
seeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskpqd
fikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddci
qfgkkhgikiininqlveyis

Sequence, based on observed residues (ATOM records):

>d2riua_ d.115.1.2 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh
ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh
gikiininqlveyis

Timeline for d2riua_:

• d2riua_ first appeared in SCOP 1.75, called d2riua1
  
• d2riua_ appears in SCOPe 2.06
  
• d2riua_ appears in the current release, SCOPe 2.08