SCOPe 2.08: Domain d2riha_: 2rih A:

Lineage for d2riha_ (2rih A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Uncharacterized protein PAE2072 [160178] (1 species)
   2 CBS domains = 1 Bateman domain; binds two adenosine nucleotides per subunit (one per one CBS repeat)

7. Species Pyrobaculum aerophilum [TaxId:13773] [160179] (2 PDB entries)
   Uniprot Q8ZVX8 2-132

8. Domain d2riha_: 2rih A: [152093]
   automated match to d2rifa1
   complexed with acy, so4

Details for d2riha_

PDB Entry: 2rih, 2.1 Å

PDB Description: cbs domain protein pae2072 from pyrobaculum aerophilum

PDB Compounds: (A:) Conserved protein with 2 CBS domains

SCOPe Domain Sequences for d2riha_:

Sequence; same for both SEQRES and ATOM records:

>d2riha_ d.37.1.1 (A:) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]}
irtsellkrppvslpetatirevatelaknrvglavltardnpkrpvavvserdilrava
qrldldgpampianspitvldtdpvhvaaekmrrhnirhvvvvnkngelvgvlsirdlcf
eraillelata

Timeline for d2riha_:

• d2riha_ first appeared in SCOP 1.75, called d2riha1
  
• d2riha_ appears in SCOPe 2.07