Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein Uncharacterized protein PAE2072 [160178] (1 species) 2 CBS domains = 1 Bateman domain; binds two adenosine nucleotides per subunit (one per one CBS repeat) |
Species Pyrobaculum aerophilum [TaxId:13773] [160179] (2 PDB entries) Uniprot Q8ZVX8 2-132 |
Domain d2riha_: 2rih A: [152093] automated match to d2rifa1 complexed with acy, so4 |
PDB Entry: 2rih (more details), 2.1 Å
SCOPe Domain Sequences for d2riha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2riha_ d.37.1.1 (A:) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} irtsellkrppvslpetatirevatelaknrvglavltardnpkrpvavvserdilrava qrldldgpampianspitvldtdpvhvaaekmrrhnirhvvvvnkngelvgvlsirdlcf eraillelata
Timeline for d2riha_: