Lineage for d2rifc1 (2rif C:2-129)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858507Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 858508Superfamily d.37.1: CBS-domain pair [54631] (1 family) (S)
  5. 858509Family d.37.1.1: CBS-domain pair [54632] (20 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 858592Protein Uncharacterized protein PAE2072 [160178] (1 species)
    2 CBS domains = 1 Bateman domain; binds two adenosine nucleotides per subunit (one per one CBS repeat)
  7. 858593Species Pyrobaculum aerophilum [TaxId:13773] [160179] (2 PDB entries)
    Uniprot Q8ZVX8 2-132
  8. 858598Domain d2rifc1: 2rif C:2-129 [152091]
    automatically matched to 2RIF A:2-132
    complexed with amp, cs

Details for d2rifc1

PDB Entry: 2rif (more details), 2.35 Å

PDB Description: cbs domain protein pae2072 from pyrobaculum aerophilum complexed with amp
PDB Compounds: (C:) Conserved protein with 2 CBS domains

SCOP Domain Sequences for d2rifc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rifc1 d.37.1.1 (C:2-129) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]}
irtsellkrppvslpetatirevatelaknrvglavltardnpkrpvavvserdilrava
qrldldgpampianspitvldtdpvhvaaekmrrhnirhvvvvnkngelvgvlsirdlcf
eraillel

SCOP Domain Coordinates for d2rifc1:

Click to download the PDB-style file with coordinates for d2rifc1.
(The format of our PDB-style files is described here.)

Timeline for d2rifc1: