Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (1 family) |
Family d.37.1.1: CBS-domain pair [54632] (20 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein Uncharacterized protein PAE2072 [160178] (1 species) 2 CBS domains = 1 Bateman domain; binds two adenosine nucleotides per subunit (one per one CBS repeat) |
Species Pyrobaculum aerophilum [TaxId:13773] [160179] (2 PDB entries) Uniprot Q8ZVX8 2-132 |
Domain d2rifc1: 2rif C:2-129 [152091] automatically matched to 2RIF A:2-132 complexed with amp, cs |
PDB Entry: 2rif (more details), 2.35 Å
SCOP Domain Sequences for d2rifc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rifc1 d.37.1.1 (C:2-129) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} irtsellkrppvslpetatirevatelaknrvglavltardnpkrpvavvserdilrava qrldldgpampianspitvldtdpvhvaaekmrrhnirhvvvvnkngelvgvlsirdlcf eraillel
Timeline for d2rifc1: