SCOP 1.69: Domain d1eca__: 1eca -

Lineage for d1eca__ (1eca -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Erythrocruorin [46479] (1 species)

7. Species Midge (Chironomus thummi thummi), fraction III [TaxId:7154] [46480] (4 PDB entries)

8. Domain d1eca__: 1eca - [15209]

Details for d1eca__

PDB Entry: 1eca, 1.4 Å

PDB Description: structure of erythrocruorin in different ligand states refined at 1.4 angstroms resolution

SCOP Domain Sequences for d1eca__:

Sequence; same for both SEQRES and ATOM records:

>d1eca__ a.1.1.2 (-) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III}
lsadqistvqasfdkvkgdpvgilyavfkadpsimakftqfagkdlesikgtapfethan
rivgffskiigelpnieadvntfvashkprgvthdqlnnfragfvsymkahtdfagaeaa
wgatldtffgmifskm

Timeline for d1eca__:

• d1eca__ first appeared (with stable ids) in SCOP 1.55
  
• d1eca__ appears in SCOP 1.67
  
• d1eca__ appears in SCOP 1.71
  
• d1eca__ appears in the current release, SCOPe 2.08, called d1ecaa_