| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Erythrocruorin [46479] (1 species) |
| Species Midge (Chironomus thummi thummi), fraction III [TaxId:7154] [46480] (4 PDB entries) |
| Domain d1ecaa_: 1eca A: [15209] complexed with hem |
PDB Entry: 1eca (more details), 1.4 Å
SCOPe Domain Sequences for d1ecaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ecaa_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}
lsadqistvqasfdkvkgdpvgilyavfkadpsimakftqfagkdlesikgtapfethan
rivgffskiigelpnieadvntfvashkprgvthdqlnnfragfvsymkahtdfagaeaa
wgatldtffgmifskm
Timeline for d1ecaa_: