![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (13 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186882] (65 PDB entries) |
![]() | Domain d2riec1: 2rie C:235-355 [152087] Other proteins in same PDB: d2riea2, d2rieb2, d2riec2 complexed with 293, ca |
PDB Entry: 2rie (more details), 1.6 Å
SCOPe Domain Sequences for d2riec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2riec1 d.169.1.0 (C:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce f
Timeline for d2riec1:
![]() Domains from other chains: (mouse over for more information) d2riea1, d2riea2, d2rieb1, d2rieb2 |