Lineage for d2ridb2 (2rid B:205-234)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2643822Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 2643823Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 2643895Protein Surfactant protein [57949] (3 species)
  7. 2643896Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)
  8. 2643937Domain d2ridb2: 2rid B:205-234 [152080]
    Other proteins in same PDB: d2rida1, d2ridb1, d2ridc1
    complexed with 291, ca

Details for d2ridb2

PDB Entry: 2rid (more details), 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with allyl 7-o- carbamoyl-l-glycero-d-manno-heptopyranoside
PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2ridb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ridb2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d2ridb2:

Click to download the PDB-style file with coordinates for d2ridb2.
(The format of our PDB-style files is described here.)

Timeline for d2ridb2: