Lineage for d2rida1 (2rid A:235-355)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002447Domain d2rida1: 2rid A:235-355 [152077]
    Other proteins in same PDB: d2rida2, d2ridb2, d2ridc2
    complexed with 291, ca

Details for d2rida1

PDB Entry: 2rid (more details), 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with allyl 7-o- carbamoyl-l-glycero-d-manno-heptopyranoside
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2rida1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rida1 d.169.1.0 (A:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d2rida1:

Click to download the PDB-style file with coordinates for d2rida1.
(The format of our PDB-style files is described here.)

Timeline for d2rida1: