SCOP 1.75: Domain d1myta_: 1myt A:

Lineage for d1myta_ (1myt A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Yellowfin tuna (Thunnus albacares) [TaxId:8236] [46478] (1 PDB entry)

8. Domain d1myta_: 1myt A: [15207]
   complexed with hem

Details for d1myta_

PDB Entry: 1myt, 1.74 Å

PDB Description: crystal structure to 1.74 angstroms resolution of metmyoglobin from yellowfin tuna (thunnus albacares): an example of a myoglobin lacking the d helix

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d1myta_:

Sequence; same for both SEQRES and ATOM records:

>d1myta_ a.1.1.2 (A:) Myoglobin {Yellowfin tuna (Thunnus albacares) [TaxId: 8236]}
adfdavlkcwgpveadyttmgglvltrlfkehpetqklfpkfagiaqadiagnaaisahg
atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmhekagldagg
qtalrnvmgiiiadleanykelgfsg

Timeline for d1myta_:

• d1myta_ first appeared (with stable ids) in SCOP 1.55, called d1myt__
  
• d1myta_ appears in SCOP 1.73
  
• d1myta_ appears in SCOPe 2.01
  
• d1myta_ appears in the current release, SCOPe 2.08