Lineage for d1myta_ (1myt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2688339Species Yellowfin tuna (Thunnus albacares) [TaxId:8236] [46478] (1 PDB entry)
  8. 2688340Domain d1myta_: 1myt A: [15207]
    complexed with hem

Details for d1myta_

PDB Entry: 1myt (more details), 1.74 Å

PDB Description: crystal structure to 1.74 angstroms resolution of metmyoglobin from yellowfin tuna (thunnus albacares): an example of a myoglobin lacking the d helix
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1myta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1myta_ a.1.1.2 (A:) Myoglobin {Yellowfin tuna (Thunnus albacares) [TaxId: 8236]}
adfdavlkcwgpveadyttmgglvltrlfkehpetqklfpkfagiaqadiagnaaisahg
atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmhekagldagg
qtalrnvmgiiiadleanykelgfsg

SCOPe Domain Coordinates for d1myta_:

Click to download the PDB-style file with coordinates for d1myta_.
(The format of our PDB-style files is described here.)

Timeline for d1myta_: