| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Myoglobin [46469] (11 species) |
| Species Yellowfin tuna (Thunnus albacares) [TaxId:8236] [46478] (1 PDB entry) |
| Domain d1myta_: 1myt A: [15207] complexed with hem |
PDB Entry: 1myt (more details), 1.74 Å
SCOPe Domain Sequences for d1myta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1myta_ a.1.1.2 (A:) Myoglobin {Yellowfin tuna (Thunnus albacares) [TaxId: 8236]}
adfdavlkcwgpveadyttmgglvltrlfkehpetqklfpkfagiaqadiagnaaisahg
atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmhekagldagg
qtalrnvmgiiiadleanykelgfsg
Timeline for d1myta_: