Lineage for d2riab1 (2ria B:235-355)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1941287Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1941288Protein automated matches [190159] (13 species)
    not a true protein
  7. 1941334Species Human (Homo sapiens) [TaxId:9606] [186882] (65 PDB entries)
  8. 1941409Domain d2riab1: 2ria B:235-355 [152061]
    Other proteins in same PDB: d2riaa2, d2riab2, d2riac2
    complexed with 289, ca

Details for d2riab1

PDB Entry: 2ria (more details), 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with d-glycero-d- manno-heptose
PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2riab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2riab1 d.169.1.0 (B:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d2riab1:

Click to download the PDB-style file with coordinates for d2riab1.
(The format of our PDB-style files is described here.)

Timeline for d2riab1: