SCOP 1.71: Domain d1lhs__: 1lhs -

Lineage for d1lhs__ (1lhs -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Loggerhead sea turtle (Caretta caretta) [TaxId:8467] [46477] (2 PDB entries)

8. Domain d1lhs__: 1lhs - [15206]
   complexed with hem

Details for d1lhs__

PDB Entry: 1lhs, 2 Å

PDB Description: loggerhead sea turtle myoglobin (aquo-met)

SCOP Domain Sequences for d1lhs__:

Sequence; same for both SEQRES and ATOM records:

>d1lhs__ a.1.1.2 (-) Myoglobin {Loggerhead sea turtle (Caretta caretta)}
glsddewnhvlgiwakvepdlsahgqeviirlfqlhpetqerfakfknlttidalkssee
vkkhgttvltalgrilkqknnheqelkplaeshatkhkipvkyleficeiivkviaekhp
sdfgadsqaamkkalelfrndmaskykefgfqg

Timeline for d1lhs__:

• d1lhs__ first appeared (with stable ids) in SCOP 1.55
  
• d1lhs__ appears in SCOP 1.69
  
• d1lhs__ is called d1lhsa_ in SCOP 1.73
  
• d1lhs__ appears in the current release, SCOPe 2.08, called d1lhsa_