Lineage for d2ri9a_ (2ri9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004325Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family) (S)
    automatically mapped to Pfam PF01532
  5. 2004326Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)
  6. 2004327Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)
  7. 2004331Species Fungus (Penicillium citrinum) [TaxId:5077] [69088] (5 PDB entries)
  8. 2004332Domain d2ri9a_: 2ri9 A: [152057]
    automated match to d1kkta_
    complexed with ca, gol

Details for d2ri9a_

PDB Entry: 2ri9 (more details), 1.95 Å

PDB Description: Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog
PDB Compounds: (A:) Mannosyl-oligosaccharide alpha-1,2-mannosidase

SCOPe Domain Sequences for d2ri9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ri9a_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Fungus (Penicillium citrinum) [TaxId: 5077]}
snqakadavkeafqhawngymkyafphdeltpvsnghadsrngwgasavdalstavimgk
advvnailehvadidfsktsdtvslfettirylagmlsgydllqgpaknlvdnqdlidgl
ldqsrnladvlkfafdtpsgvpynninitshgndgattnglavtgtlvlewtrlsdltgd
eeyaklsqkaesyllkpqpsssepfpglvgssinindgqfadsrvswnggddsfyeylik
myvydpkrfetykdrwvlaaestikhlkshpksrpdltflssysnrnydlssqhltcfdg
gsfllggtvldrqdfidfglelvdgceatynstltkigpdswgwdpkkvpsdqkefyeka
gfyissgsyvlrpeviesfyyahrvtgkeiyrdwvwnafvainstcrtdsgfaavsdvnk
anggskydnqesflfaevmkysylahsedaawqvqkggkntfvynteahpisvar

SCOPe Domain Coordinates for d2ri9a_:

Click to download the PDB-style file with coordinates for d2ri9a_.
(The format of our PDB-style files is described here.)

Timeline for d2ri9a_: