Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins) closely related to the Proline iminopeptidase-like family |
Protein 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) [53523] (2 species) |
Species Burkholderia xenovorans [TaxId:36873] [159736] (13 PDB entries) Uniprot P47229 4-286 |
Domain d2rhta_: 2rht A: [152052] automated match to d2puha1 complexed with c1e, mli, na; mutant |
PDB Entry: 2rht (more details), 1.7 Å
SCOPe Domain Sequences for d2rhta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhta_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} ltesstskfvkinekgfsdfnihyneagngetvimlhgggpgaggwsnyyrnvgpfvdag yrvilkdspgfnksdavvmdeqrglvnaravkglmdaldidrahlvgnamggatalnfal eypdrigklilmgpgglgpsmfapmpmegikllfklyaepsyetlkqmlqvflydqslit eellqgrweaiqrqpehlknflisaqkaplstwdvtarlgeikaktfitwgrddrfvpld hglkllwniddarlhvfskcghwaqwehadefnrlvidflrha
Timeline for d2rhta_: