Lineage for d1lhta_ (1lht A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474672Protein Myoglobin [46469] (9 species)
  7. 1474748Species Loggerhead sea turtle (Caretta caretta) [TaxId:8467] [46477] (2 PDB entries)
  8. 1474749Domain d1lhta_: 1lht A: [15205]
    complexed with cyn, hem

Details for d1lhta_

PDB Entry: 1lht (more details), 2 Å

PDB Description: loggerhead sea turtle myoglobin (cyano-met)
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1lhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lhta_ a.1.1.2 (A:) Myoglobin {Loggerhead sea turtle (Caretta caretta) [TaxId: 8467]}
glsddewnhvlgiwakvepdlsahgqeviirlfqlhpetqerfakfknlttidalkssee
vkkhgttvltalgrilkqknnheqelkplaeshatkhkipvkyleficeiivkviaekhp
sdfgadsqaamkkalelfrndmaskykefgfqg

SCOPe Domain Coordinates for d1lhta_:

Click to download the PDB-style file with coordinates for d1lhta_.
(The format of our PDB-style files is described here.)

Timeline for d1lhta_: