Lineage for d2rhcb_ (2rhc B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
also known as short-chain dehydrogenases and SDR family
parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
Protein beta-keto acyl carrier protein reductase [51788] (8 species) 
Species Streptomyces coelicolor [TaxId:1902] [117408] (8 PDB entries)
Uniprot P16544 #SP
Domain d2rhcb_: 2rhc B: [152049]
automated match to d1w4zb_
complexed with emo, nap
Details for d2rhcb_
PDB Entry: 2rhc (more details), 2.1 Å
PDB Description: actinorhodin ketordeuctase, actkr, with nadp+ and inhibitor emodin
PDB Compounds: (B:) Actinorhodin Polyketide KetoreductaseSCOPe Domain Sequences for d2rhcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhcb_ c.2.1.2 (B:) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}
lvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelrea
gveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvet
nltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalgl
elartgitvnavcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpseva
emvayligpgaaavtaqalnvcgglgny
SCOPe Domain Coordinates for d2rhcb_:
Click to download the PDB-style file with coordinates for d2rhcb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2rhcb_:
- d2rhcb_ first appeared in SCOP 1.75, called d2rhcb1
- d2rhcb_ appears in SCOPe 2.04
- d2rhcb_ is called d2rhcb2 in SCOPe 2.06
- d2rhcb_ appears in the current release, SCOPe 2.08, called d2rhcb2
View in 3D
