Lineage for d2rhcb2 (2rhc B:1-261)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841624Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 2841653Species Streptomyces coelicolor [TaxId:1902] [117408] (8 PDB entries)
    Uniprot P16544 #SP
  8. 2841661Domain d2rhcb2: 2rhc B:1-261 [152049]
    Other proteins in same PDB: d2rhcb3
    automated match to d1w4zb_
    complexed with emo, nap

Details for d2rhcb2

PDB Entry: 2rhc (more details), 2.1 Å

PDB Description: actinorhodin ketordeuctase, actkr, with nadp+ and inhibitor emodin
PDB Compounds: (B:) Actinorhodin Polyketide Ketoreductase

SCOPe Domain Sequences for d2rhcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhcb2 c.2.1.2 (B:1-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}
matqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgr
tcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfr
vtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgi
tvnavcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayli
gpgaaavtaqalnvcgglgny

SCOPe Domain Coordinates for d2rhcb2:

Click to download the PDB-style file with coordinates for d2rhcb2.
(The format of our PDB-style files is described here.)

Timeline for d2rhcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rhcb3
View in 3D
Domains from other chains:
(mouse over for more information)
d2rhca_