Lineage for d2rhca1 (2rhc A:5-261)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 819899Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 819932Species Streptomyces coelicolor [TaxId:1902] [117408] (6 PDB entries)
    Uniprot P16544 #SP
  8. 819933Domain d2rhca1: 2rhc A:5-261 [152048]
    automatically matched to d1w4zb_
    complexed with emo, nap

Details for d2rhca1

PDB Entry: 2rhc (more details), 2.1 Å

PDB Description: actinorhodin ketordeuctase, actkr, with nadp+ and inhibitor emodin
PDB Compounds: (A:) Actinorhodin Polyketide Ketoreductase

SCOP Domain Sequences for d2rhca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}
dsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtcdv
rsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfrvtkq
vlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitvna
vcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligpga
aavtaqalnvcgglgny

SCOP Domain Coordinates for d2rhca1:

Click to download the PDB-style file with coordinates for d2rhca1.
(The format of our PDB-style files is described here.)

Timeline for d2rhca1: