![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.294: EndoU-like [142876] (1 superfamily) comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075) |
![]() | Superfamily d.294.1: EndoU-like [142877] (3 families) ![]() similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily) |
![]() | Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins) PfamB PB001946 |
![]() | Protein Nsp15, C-terminal domain [142882] (2 species) |
![]() | Species SARS coronavirus [TaxId:227859] [142883] (3 PDB entries) Uniprot Q6VA80 6620-6774 |
![]() | Domain d2rhbf2: 2rhb F:191-344 [152047] Other proteins in same PDB: d2rhba1, d2rhba3, d2rhbb1, d2rhbb3, d2rhbc1, d2rhbc3, d2rhbd1, d2rhbd3, d2rhbe1, d2rhbe3, d2rhbf1 automated match to d2h85a2 mutant |
PDB Entry: 2rhb (more details), 2.8 Å
SCOPe Domain Sequences for d2rhbf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhbf2 d.294.1.2 (F:191-344) Nsp15, C-terminal domain {SARS coronavirus [TaxId: 227859]} etyftqsrdledfkprsqmetdflelamdefiqryklegyafeaivygdfshgqlgglhl miglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd lsviskvvkvtidyaeisfmlwckdghvetfypk
Timeline for d2rhbf2: