Lineage for d2rhbf1 (2rhb F:1-190)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894145Family c.66.1.48: Nsp15 N-terminal domain-like [142625] (2 proteins)
    rudiment methyltransferase fold that probably has lost the enzymatic activity; contains extra N-terminal alpha+beta subdomain
  6. 2894146Protein Nsp15 [142626] (2 species)
  7. 2894150Species SARS coronavirus [TaxId:227859] [142628] (3 PDB entries)
    Uniprot Q6VA80 6619-6774
  8. 2894157Domain d2rhbf1: 2rhb F:1-190 [152046]
    Other proteins in same PDB: d2rhba2, d2rhba3, d2rhbb2, d2rhbb3, d2rhbc2, d2rhbc3, d2rhbd2, d2rhbd3, d2rhbe2, d2rhbe3, d2rhbf2
    automated match to d2h85a1
    mutant

Details for d2rhbf1

PDB Entry: 2rhb (more details), 2.8 Å

PDB Description: crystal structure of nsp15-h234a mutant- hexamer in asymmetric unit
PDB Compounds: (F:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d2rhbf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhbf1 c.66.1.48 (F:1-190) Nsp15 {SARS coronavirus [TaxId: 227859]}
slenvaynvvnkghfdghageapvsiinnavytkvdgidveifenkttlpvnvafelwak
rnikpvpeikilnnlgvdiaantviwdykreapahvstigvctmtdiakkptesacsslt
vlfdgrvegqvdlfrnarngvlitegsvkgltpskgpaqasvngvtligesvktqfnyfk
kvdgiiqqlp

SCOPe Domain Coordinates for d2rhbf1:

Click to download the PDB-style file with coordinates for d2rhbf1.
(The format of our PDB-style files is described here.)

Timeline for d2rhbf1: