Lineage for d2rhbe2 (2rhb E:191-344)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882130Fold d.294: EndoU-like [142876] (1 superfamily)
    comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold ((54075))
    comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold ((54075))
  4. 882131Superfamily d.294.1: EndoU-like [142877] (2 families) (S)
    similarity to the RNase A-like superfamily ((54076)) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)
  5. 882138Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (1 protein)
    PfamB PB001946
  6. 882139Protein Nsp15, C-terminal domain [142882] (2 species)
  7. 882143Species SARS coronavirus [TaxId:227859] [142883] (3 PDB entries)
    Uniprot Q6VA80 6620-6774
  8. 882149Domain d2rhbe2: 2rhb E:191-344 [152045]
    Other proteins in same PDB: d2rhba1, d2rhbb1, d2rhbc1, d2rhbd1, d2rhbe1, d2rhbf1
    automatically matched to d2h85a2
    mutant

Details for d2rhbe2

PDB Entry: 2rhb (more details), 2.8 Å

PDB Description: crystal structure of nsp15-h234a mutant- hexamer in asymmetric unit
PDB Compounds: (E:) Uridylate-specific endoribonuclease

SCOP Domain Sequences for d2rhbe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhbe2 d.294.1.2 (E:191-344) Nsp15, C-terminal domain {SARS coronavirus [TaxId: 227859]}
etyftqsrdledfkprsqmetdflelamdefiqryklegyafeaivygdfshgqlgglhl
miglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsviskvvkvtidyaeisfmlwckdghvetfypk

SCOP Domain Coordinates for d2rhbe2:

Click to download the PDB-style file with coordinates for d2rhbe2.
(The format of our PDB-style files is described here.)

Timeline for d2rhbe2: