SCOPe 2.04: Domain d1emya_: 1emy A:

Lineage for d1emya_ (1emy A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Asian elephant (Elephas maximus) [TaxId:9783] [46476] (1 PDB entry)

8. Domain d1emya_: 1emy A: [15204]
   complexed with cyn, hem

Details for d1emya_

PDB Entry: 1emy, 1.78 Å

PDB Description: crystal structure of asian elephant (elephas maximus) cyano-met myoglobin at 1.78 angstroms resolution. phe 29 (b10) accounts for its unusual ligand binding properties

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1emya_:

Sequence; same for both SEQRES and ATOM records:

>d1emya_ a.1.1.2 (A:) Myoglobin {Asian elephant (Elephas maximus) [TaxId: 9783]}
glsdgewelvlktwgkveadipghgetvfvrlftghpetlekfdkfkhlktegemkased
lkkqgvtvltalggilkkkghheaeiqplaqshatkhkipikylefisdaiihvlqskhp
aefgadaqgamkkalelfrndiaakykelgfqg

Timeline for d1emya_:

• d1emya_ first appeared (with stable ids) in SCOP 1.55, called d1emy__
  
• d1emya_ appears in SCOPe 2.03
  
• d1emya_ appears in SCOPe 2.05
  
• d1emya_ appears in the current release, SCOPe 2.08