Lineage for d2rhba2 (2rhb A:191-344)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615811Fold d.294: EndoU-like [142876] (1 superfamily)
    comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)
  4. 2615812Superfamily d.294.1: EndoU-like [142877] (3 families) (S)
    similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)
  5. 2615821Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins)
    PfamB PB001946
  6. 2615822Protein Nsp15, C-terminal domain [142882] (2 species)
  7. 2615826Species SARS coronavirus [TaxId:227859] [142883] (3 PDB entries)
    Uniprot Q6VA80 6620-6774
  8. 2615828Domain d2rhba2: 2rhb A:191-344 [152037]
    Other proteins in same PDB: d2rhba1, d2rhba3, d2rhbb1, d2rhbb3, d2rhbc1, d2rhbc3, d2rhbd1, d2rhbd3, d2rhbe1, d2rhbe3, d2rhbf1
    automated match to d2h85a2
    mutant

Details for d2rhba2

PDB Entry: 2rhb (more details), 2.8 Å

PDB Description: crystal structure of nsp15-h234a mutant- hexamer in asymmetric unit
PDB Compounds: (A:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d2rhba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhba2 d.294.1.2 (A:191-344) Nsp15, C-terminal domain {SARS coronavirus [TaxId: 227859]}
etyftqsrdledfkprsqmetdflelamdefiqryklegyafeaivygdfshgqlgglhl
miglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsviskvvkvtidyaeisfmlwckdghvetfypk

SCOPe Domain Coordinates for d2rhba2:

Click to download the PDB-style file with coordinates for d2rhba2.
(The format of our PDB-style files is described here.)

Timeline for d2rhba2: