SCOPe 2.06: Domain d2rh9b_: 2rh9 B:

Lineage for d2rh9b_ (2rh9 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein automated matches [190054] (13 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189633] (13 PDB entries)

8. Domain d2rh9b_: 2rh9 B: [152035]
   Other proteins in same PDB: d2rh9a_
   automated match to d2tysb_
   complexed with igp, na, plp

Details for d2rh9b_

PDB Entry: 2rh9, 1.7 Å

PDB Description: Tryptophan synthase complexed with IGP, internal aldimine, pH 9.0

PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d2rh9b_:

Sequence; same for both SEQRES and ATOM records:

>d2rh9b_ c.79.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarg

Timeline for d2rh9b_:

• d2rh9b_ first appeared in SCOP 1.75, called d2rh9b1
  
• d2rh9b_ appears in SCOPe 2.05
  
• d2rh9b_ appears in SCOPe 2.07
  
• d2rh9b_ appears in the current release, SCOPe 2.08