Lineage for d2rh7d_ (2rh7 D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2508389Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2508393Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2508683Species Renilla reniformis [TaxId:6136] [160126] (2 PDB entries)
    Uniprot Q963I9 7-226
  8. 2508687Domain d2rh7d_: 2rh7 D: [152033]
    automated match to d1mova_

Details for d2rh7d_

PDB Entry: 2rh7 (more details), 1.5 Å

PDB Description: Crystal Structures of the Luciferase and Green Fluorescent Protein from Renilla Reniformis
PDB Compounds: (D:) Green fluorescent protein

SCOPe Domain Sequences for d2rh7d_:

Sequence, based on SEQRES records: (download)

>d2rh7d_ d.22.1.1 (D:) Green fluorescent protein, GFP {Renilla reniformis [TaxId: 6136]}
glkevmptkinleglvgdhafsmegvgegnilegtqevkisvtkgaplpfafdivsvafg
ygnraytgypeeisdyflqsfpegftyerniryqdggtaivksdisledgkfivnvdfka
kdlrrmgpvmqqdivgmqpsyesmytnvtsvigeciiafklqtgkhftyhmrtvykskkp
vetmplyhfiqhrlvktnvdtasgyvvqhetaiaahstik

Sequence, based on observed residues (ATOM records): (download)

>d2rh7d_ d.22.1.1 (D:) Green fluorescent protein, GFP {Renilla reniformis [TaxId: 6136]}
glkevmptkinleglvgdhafsmegvgegnilegtqevkisvtkgaplpfafdivsvafg
ygnraytgypeeisdyflqsfpegftyerniryqdggtaivksdislegkfivnvdfkak
dlrrmgpvmqqdivgmqpsyesmytnvtsvigeciiafklqtgkhftyhmrtvykskkpv
etmplyhfiqhrlvktnvyvvqhetaiaahstik

SCOPe Domain Coordinates for d2rh7d_:

Click to download the PDB-style file with coordinates for d2rh7d_.
(The format of our PDB-style files is described here.)

Timeline for d2rh7d_: