Lineage for d2rh7b_ (2rh7 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2164737Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2164983Species Renilla reniformis [TaxId:6136] [160126] (2 PDB entries)
    Uniprot Q963I9 7-226
  8. 2164985Domain d2rh7b_: 2rh7 B: [152031]
    automated match to d1mova_

Details for d2rh7b_

PDB Entry: 2rh7 (more details), 1.5 Å

PDB Description: Crystal Structures of the Luciferase and Green Fluorescent Protein from Renilla Reniformis
PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d2rh7b_:

Sequence, based on SEQRES records: (download)

>d2rh7b_ d.22.1.1 (B:) Green fluorescent protein, GFP {Renilla reniformis [TaxId: 6136]}
glkevmptkinleglvgdhafsmegvgegnilegtqevkisvtkgaplpfafdivsvafg
ygnraytgypeeisdyflqsfpegftyerniryqdggtaivksdisledgkfivnvdfka
kdlrrmgpvmqqdivgmqpsyesmytnvtsvigeciiafklqtgkhftyhmrtvykskkp
vetmplyhfiqhrlvktnvdtasgyvvqhetaiaahstik

Sequence, based on observed residues (ATOM records): (download)

>d2rh7b_ d.22.1.1 (B:) Green fluorescent protein, GFP {Renilla reniformis [TaxId: 6136]}
glkevmptkinleglvgdhafsmegvgegnilegtqevkisvtkgaplpfafdivsvafg
ygnraytgypeeisdyflqsfpegftyerniryqdggtaivksdisledgkfivnvdfka
kdlrrmgpvmqqdivgmqpsyesmytnvtsvigeciiafklqtgkhftyhmrtvykskkp
vetmplyhfiqhrlvktnvyvvqhetaiaahstik

SCOPe Domain Coordinates for d2rh7b_:

Click to download the PDB-style file with coordinates for d2rh7b_.
(The format of our PDB-style files is described here.)

Timeline for d2rh7b_: