SCOP 1.71: Domain d2mm1__: 2mm1 -

Lineage for d2mm1__ (2mm1 -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46475] (1 PDB entry)

8. Domain d2mm1__: 2mm1 - [15203]
   complexed with hem; mutant

Details for d2mm1__

PDB Entry: 2mm1, 2.8 Å

PDB Description: x-ray crystal structure of a recombinant human myoglobin mutant at 2.8 angstroms resolution

SCOP Domain Sequences for d2mm1__:

Sequence; same for both SEQRES and ATOM records:

>d2mm1__ a.1.1.2 (-) Myoglobin {Human (Homo sapiens)}
glsdgewqlvlnvwgkveadipghgqevlirlfkghpetlekfdrfkhlksedemkased
lkkhgatvltalggilkkkghheaeikplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamnkalelfrkdmasnykelgfqg

Timeline for d2mm1__:

• d2mm1__ first appeared (with stable ids) in SCOP 1.55
  
• d2mm1__ appears in SCOP 1.69
  
• d2mm1__ is called d2mm1a_ in SCOP 1.73
  
• d2mm1__ last appears in SCOP 1.75, called d2mm1a_