SCOPe 2.05: Domain d2rh3a1: 2rh3 A:82-202

Lineage for d2rh3a1 (2rh3 A:82-202)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.10: VirC2-like [158482] (1 protein)
   Pfam PF07181; duplicated ribbon-helix-helix motif; fold forms a trefoil knot

6. Protein VirC2 [158483] (1 species)
   Encoded by Ti plasmid

7. Species Agrobacterium tumefaciens [TaxId:358] [158484] (1 PDB entry)
   Uniprot P07166 82-202

8. Domain d2rh3a1: 2rh3 A:82-202 [152027]

Details for d2rh3a1

PDB Entry: 2rh3, 1.7 Å

PDB Description: crystal structure of plasmid ptic58 virc2

PDB Compounds: (A:) Protein virC2

SCOPe Domain Sequences for d2rh3a1:

Sequence; same for both SEQRES and ATOM records:

>d2rh3a1 a.43.1.10 (A:82-202) VirC2 {Agrobacterium tumefaciens [TaxId: 358]}
iqvflsarppapevskiydnlilqyspskslqmilrralgdfenmladgsfraapksypi
phtafeksiivqtsrmfpvslieaarnhfdplgletarafghklataalacffarekatn
s

Timeline for d2rh3a1:

• d2rh3a1 first appeared in SCOP 1.75
  
• d2rh3a1 appears in SCOPe 2.04
  
• d2rh3a1 appears in SCOPe 2.06
  
• d2rh3a1 appears in the current release, SCOPe 2.08