![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
![]() | Family a.43.1.10: VirC2-like [158482] (1 protein) Pfam PF07181; duplicated ribbon-helix-helix motif; fold forms a trefoil knot |
![]() | Protein VirC2 [158483] (1 species) Encoded by Ti plasmid |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [158484] (1 PDB entry) Uniprot P07166 82-202 |
![]() | Domain d2rh3a1: 2rh3 A:82-202 [152027] |
PDB Entry: 2rh3 (more details), 1.7 Å
SCOPe Domain Sequences for d2rh3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rh3a1 a.43.1.10 (A:82-202) VirC2 {Agrobacterium tumefaciens [TaxId: 358]} iqvflsarppapevskiydnlilqyspskslqmilrralgdfenmladgsfraapksypi phtafeksiivqtsrmfpvslieaarnhfdplgletarafghklataalacffarekatn s
Timeline for d2rh3a1: