| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
| Family b.34.4.1: R67 dihydrofolate reductase [50091] (2 proteins) |
| Protein automated matches [190309] (1 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187228] (8 PDB entries) |
| Domain d2rh2a_: 2rh2 A: [152026] automated match to d1viea_ complexed with mrd |
PDB Entry: 2rh2 (more details), 0.96 Å
SCOPe Domain Sequences for d2rh2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rh2a_ b.34.4.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
natfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin
Timeline for d2rh2a_: