Lineage for d2rh2a_ (2rh2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783742Family b.34.4.1: R67 dihydrofolate reductase [50091] (2 proteins)
  6. 2783747Protein automated matches [190309] (1 species)
    not a true protein
  7. 2783748Species Escherichia coli [TaxId:562] [187228] (8 PDB entries)
  8. 2783749Domain d2rh2a_: 2rh2 A: [152026]
    automated match to d1viea_
    complexed with mrd

Details for d2rh2a_

PDB Entry: 2rh2 (more details), 0.96 Å

PDB Description: High Resolution DHFR R-67
PDB Compounds: (A:) Dihydrofolate reductase type 2

SCOPe Domain Sequences for d2rh2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rh2a_ b.34.4.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
natfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin

SCOPe Domain Coordinates for d2rh2a_:

Click to download the PDB-style file with coordinates for d2rh2a_.
(The format of our PDB-style files is described here.)

Timeline for d2rh2a_: